peptide link

См. также в других словарях:

• Peptide deformylase — In enzymology, a peptide deformylase (EC number|3.5.1.88) is an enzyme that catalyzes the chemical reaction:formyl L methionyl peptide + H2O ightleftharpoons formate + methionyl peptideThus, the two substrates of this enzyme are formyl L… …   Wikipedia

• Peptide-N4-(N-acetyl-beta-glucosaminyl)asparagine amidase — In enzymology, a peptide N4 (N acetyl beta glucosaminyl)asparagine amidase (EC number|3.5.1.52) is an enzyme that catalyzes a chemical reaction that cleaves a N4 (acetyl beta D glucosaminyl)asparagine residue in which the glucosamine residue may… …   Wikipedia

• Peptide-aspartate beta-dioxygenase — In enzymology, a peptide aspartate beta dioxygenase (EC number|1.14.11.16) is an enzyme that catalyzes the chemical reaction:peptide L aspartate + 2 oxoglutarate + O2 ightleftharpoons peptide 3 hydroxy L aspartate + succinate + CO2The 3… …   Wikipedia

• Peptide C —  Le peptide C ne doit pas être confondu avec la protéine C réactive ou la protéine C. Peptide C …   Wikipédia en Français

• Peptide alpha-N-acetyltransferase — In enzymology, a peptide alpha N acetyltransferase (EC number|2.3.1.88) is an enzyme that catalyzes the chemical reaction:acetyl CoA + peptide ightleftharpoons Nalpha acetylpeptide + CoAThus, the two substrates of this enzyme are acetyl CoA and… …   Wikipedia

• Glutaminyl-peptide cyclotransferase — In enzymology, a glutaminyl peptide cyclotransferase (EC number|2.3.2.5) is an enzyme that catalyzes the chemical reaction:L glutaminyl peptide ightleftharpoons 5 oxoprolyl peptide + NH3Hence, this enzyme has one substrate, L glutaminyl peptide,… …   Wikipedia

• Delta sleep-inducing peptide — Identifiers Symbol DSIP UniProt P01158 Other data Delta sleep inducing peptide, abbreviated DSIP, is a neuropeptide that when infused int …   Wikipedia

• Brain natriuretic peptide — Natriuretisches Peptid Typ B BNP mit ANP Rezeptor nach PDB  …   Deutsch Wikipedia

• Glucagon-like peptide 2 receptor — The gene for the glucagon like peptide 2 receptor (GLP 2) is on chromosome 17.cite journal | author = Brubaker PL, Drucker DJ | title = Structure function of the glucagon receptor family of G protein coupled receptors: the glucagon, GIP, GLP 1,… …   Wikipedia

• Glucagon-like peptide-2 — (GLP 2) is a 33 amino acid peptide with the sequence HADGSFSDEMNTILDNLAARDFINWLIQTKITD in humans. GLP 2 is created by specific post translational proteolytic cleavage of proglucagon in a process that also liberates the related glucagon like… …   Wikipedia

• Genome-Based Peptide Fingerprint Scanning — (GFS) is a system in bioinformatics analysis that attempts to identify the genomic origin (i.e. what species they come from) of sample proteins by scanning their peptide mass fingerprint against the theoretical translation and proteolytic digest… …   Wikipedia